PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06996g02039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 149aa    MW: 16463.2 Da    PI: 10.624
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06996g02039.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.64e-192154134
                      GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                              C+ C+ttkTplWR gp g+k+LCnaCG++yrkk+
  Niben101Scf06996g02039.1 21 CTDCKTTKTPLWRVGPYGPKSLCNACGIKYRKKN 54
                              ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.7E-171572IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.9671551IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.95E-131755No hitNo description
Gene3DG3DSA:3.30.50.101.5E-151954IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.24E-122054No hitNo description
PfamPF003204.4E-172154IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MDPTQKEDSL ADETTESAKS CTDCKTTKTP LWRVGPYGPK SLCNACGIKY RKKNGTPSGF  60
SKDPKKKKET DISNSSTDKL AHSKKDKIGK DGKLSKGLKV RFMMLGKEVV ILQRQRSSMK  120
KKPTSRRKFG EVERAALLLM ALSCGSVFA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15067RKKNGTPSGFSKDPKKKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788710.13e-97PREDICTED: GATA transcription factor 17-like
RefseqXP_016454370.13e-97PREDICTED: GATA transcription factor 17-like
TrEMBLA0A0V0HCG42e-65A0A0V0HCG4_SOLCH; Putative GATA transcription factor 17-like
TrEMBLM1CB782e-65M1CB78_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000637716e-65(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA127501721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06740.11e-28GATA transcription factor 15